PageSourceSearch

Third-party host

Websites loading from kanawhavalleytrailalliance.wildapricot.org

1 website loads from this host according to the stored source@if (Model.Total > HostModel.MaxSites) { ; the 200 highest-ranked are listed }. script, iframe and stylesheet are tags in the HTML; connect is an absolute URL inside one of the site's own scripts.

#WebsiteRankLoaded as
1 wvmba.netlify.app connect view source

Questions

Which websites load from kanawhavalleytrailalliance.wildapricot.org?
The 1 site listed on this page. A site is listed when its stored HTML has a script, iframe or stylesheet from the host, or one of its own scripts names the host in an absolute URL.
Is kanawhavalleytrailalliance.wildapricot.org a third party for every site listed?
Yes: a host under a site's own registrable domain is never recorded for that site, so every site here loads from kanawhavalleytrailalliance.wildapricot.org as a dependency outside its own domain.

Most loaded hosts · sites by tracking ID · look up a site